PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc10_g13150
Common NameGSCOC_T00035333001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family GRAS
Protein Properties Length: 570aa    MW: 63819.6 Da    PI: 4.6549
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc10_g13150genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS445.34.1e-1362015693374
         GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                  + L++cA a+++g++ +a++++++l++++s +g+p +R+aay++eAL ar+a s+++lykal+++e +   ss++l+a+++++ev+P+++f+++taN 
  Cc10_g13150 201 QMLFDCAAAIQDGNFDEASTIINELRQRVSIQGEPPERIAAYMVEALVARMATSGKGLYKALKCKEPP---SSDRLSAMQVLFEVCPCFRFGFMTANG 295
                  79*****************************************************************9...9************************** PP

         GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  aIlea + e+rvHiiDfdi+qG Q+ +Llq+La+ p +p +lR+Tgv++pes+      l+ +g+ L+ fAe l++p+ f+  va +++d+++++L++
  Cc10_g13150 296 AILEACKDEKRVHIIDFDINQGSQYYTLLQTLAQLPYKPSHLRLTGVDDPESVqrAVGGLNIIGQMLETFAEDLKIPLTFHS-VAAKTADIDPSMLDC 392
                  ***************************************************99878889***********************.7999*********** PP

         GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                  kpgEal+Vn+++qlh+++desvs+ ++rd++L++vk+l+Pk+v++veq++++n+++Fl+rf+ea +yysa+fdslea+lpr+ +er++vEr++l+r+i
  Cc10_g13150 393 KPGEALIVNFAFQLHHMPDESVSTVNQRDQLLRMVKGLNPKLVTLVEQDVNTNTAPFLQRFAEAYSYYSAVFDSLEATLPRDGQERMNVERQCLARDI 490
                  ************************************************************************************************** PP

         GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                   n+vaceg+er+er e ++kWr+r+++aGF++ p+++++ ++++ l+++++++ y+v+ee g++ +gW+d+ L+++SaWr
  Cc10_g13150 491 INIVACEGEERIERYEVAGKWRARMMMAGFTSSPIGQNVKDEIRKLIKQYSER-YKVKEETGAVHFGWEDKILIAASAWR 569
                  ***************************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.389173550IPR005202Transcription factor GRAS
PfamPF035141.4E-133201569IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    Send to blast
MSLVKSASSF RNRKLYSLKD SRNNSGFSKA ILEKQQGITY SSESYSDGSY DPKYFLESPS  60
EEFAHSSISD VLGIRFDSPH PSSNQLLAGQ HSFSNSFMPA KQCDTYEFSF ESEYLGAEDP  120
DATDYDEDEV RLKLQELERA LFDDNNIVDN DLLETEHGWA DSTENVLLHD SPKESSSSDS  180
NLSSISSNKE ISVTTPPGPK QMLFDCAAAI QDGNFDEAST IINELRQRVS IQGEPPERIA  240
AYMVEALVAR MATSGKGLYK ALKCKEPPSS DRLSAMQVLF EVCPCFRFGF MTANGAILEA  300
CKDEKRVHII DFDINQGSQY YTLLQTLAQL PYKPSHLRLT GVDDPESVQR AVGGLNIIGQ  360
MLETFAEDLK IPLTFHSVAA KTADIDPSML DCKPGEALIV NFAFQLHHMP DESVSTVNQR  420
DQLLRMVKGL NPKLVTLVEQ DVNTNTAPFL QRFAEAYSYY SAVFDSLEAT LPRDGQERMN  480
VERQCLARDI INIVACEGEE RIERYEVAGK WRARMMMAGF TSSPIGQNVK DEIRKLIKQY  540
SERYKVKEET GAVHFGWEDK ILIAASAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-552015696375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101898.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101891.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101887.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101883.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA0A068UU850.0A0A068UU85_COFCA; Uncharacterized protein
STRINGSolyc04g064550.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA89672429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1